
Atlas Antibodies Anti-PSMB11 Antibody
상품 한눈에 보기
Human PSMB11 단백질을 인식하는 고품질 폴리클로날 항체. IHC 검증 완료 및 독립 항체 비교를 통한 신뢰성 확보. Rabbit 유래 IgG, Affinity purified. Proteasome subunit beta 11 연구용에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PSMB11 Antibody
Target Protein: proteasome subunit beta 11
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PSMB11
Alternative Gene Names
beta5t
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | proteasome subunit beta 11 |
| Target Gene | PSMB11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000047091 (90%), Mouse ENSMUSG00000072423 (90%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
AADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALAR제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PSMB10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMB11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.