Atlas Antibodies Anti-PSMB10 Antibody

상품 한눈에 보기

인간 PSMB10 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, 친화 정제된 고품질 Rabbit IgG 항체입니다. 다양한 조직에서 단백질 발현 분석에 활용 가능합니다.

카탈로그번호: HPA030225-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030225-100 Anti-PSMB10 Antibody, proteasome (prosome, macropain) subunit, beta type, 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030225-25 Anti-PSMB10 Antibody, proteasome (prosome, macropain) subunit, beta type, 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PSMB10 Antibody

Anti-PSMB10 Antibody

Target Protein: proteasome (prosome, macropain) subunit, beta type, 10
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human PSMB10

Alternative Gene Names

beta2i, LMP10, MECL1, MGC1665

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVT

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000019494	92%
Mouse	ENSMUSG00000031897	89%

Antibody Characteristics

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand