CacheBy
Atlas Antibodies Anti-PSMB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB1 Antibody

상품 한눈에 보기

Human PSMB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 사용 가능. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 보임. 40% 글리세롤 및 PBS 완충액에 보존제 포함.

카탈로그번호
HPA029635-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029635-100 Anti-PSMB1 Antibody, proteasome (prosome, macropain) subunit, beta type, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029635-25 Anti-PSMB1 Antibody, proteasome (prosome, macropain) subunit, beta type, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB1 Antibody

Anti-PSMB1 Antibody

Target: proteasome (prosome, macropain) subunit, beta type, 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PSMB1.


Alternative Gene Names

HC5, PMSB1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) subunit, beta type, 1
Target Gene PSMB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000014769 (98%), Rat ENSRNOG00000001488 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
WB Validation
ICC Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.