Atlas Antibodies Anti-PRKCB Antibody
상품 한눈에 보기
인간 PRKCB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PRKCB1/2 유전자에 대한 높은 특이성을 가지며, 정제된 IgG 형태로 제공됩니다. Rat 및 Mouse와 100% 서열 동일성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRKCB Antibody
Target: protein kinase C, beta
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PRKCB.
Alternative Gene Names
PKCB, PRKCB1, PRKCB2
Antigen Information
- Antigen Sequence (PrEST):
EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVIN
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000012061 | 100% |
| Mouse | ENSMUSG00000052889 | 100% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-PRKCB Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PRKCDBP Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PRKCB Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PRKCA Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-PRKCA Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.