CacheBy
Atlas Antibodies Anti-PRKCA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRKCA Antibody

상품 한눈에 보기

Human PRKCA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation을 통해 신뢰성 검증 완료. 고순도 Affinity 정제 및 다양한 종(인간, 마우스, 랫드) 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA006563-100 Anti-PRKCA Antibody, protein kinase C, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006563-25 Anti-PRKCA Antibody, protein kinase C, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRKCA Antibody

Anti-PRKCA Antibody

Target: protein kinase C, alpha (PRKCA)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Orthogonal validation
  • ICC (Immunocytochemistry)

Orthogonal validation:
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human PRKCA


Alternative Gene Names

  • PKCA

Open Datasheet


Target Information

항목 내용
Target Protein protein kinase C, alpha
Target Gene PRKCA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRST

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000050965 (99%)
  • Rat ENSRNOG00000003491 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.