
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PRKCA Antibody
상품 한눈에 보기
Human PRKCA 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB(Orthogonal), ICC에 적합. 높은 종간 보존성(인간, 마우스, 랫트 99%)을 가지며, PrEST 항원으로 정제됨. PBS 및 글리세롤 완충액에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA006564-100 Anti-PRKCA Antibody, protein kinase C, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006564-25 Anti-PRKCA Antibody, protein kinase C, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRKCA Antibody
Anti-PRKCA Antibody
Target: protein kinase C, alpha (PRKCA)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. - ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human PRKCA
Alternative Gene Names
- PKCA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein kinase C, alpha |
| Target Gene | PRKCA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRST |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000050965 (99%)
- Rat ENSRNOG00000003491 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



