
Atlas Antibodies Anti-PPP4R4 Antibody
상품 한눈에 보기
인간 PPP4R4 단백질에 특이적인 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 친화정제 방식으로 높은 순도를 제공합니다. 인간에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP4R4 Antibody
Target Protein: protein phosphatase 4, regulatory subunit 4
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human PPP4R4 (protein phosphatase 4, regulatory subunit 4).
Alternative Gene Names
CFAP14, KIAA1622, PP4R4
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021209 | 98% |
| Rat | ENSRNOG00000054052 | 96% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Recommended Applications
- Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP6C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP5C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP4R4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP4R4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP4R2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.