
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP4R4 Antibody
상품 한눈에 보기
Human PPP4R4 단백질을 인식하는 토끼 폴리클로날 항체로, 단백질 인산화효소 4 조절 서브유닛 4 연구에 적합합니다. 높은 종 간 보존성(인간-마우스 98%)을 가지며, PrEST 항원으로 정제되었습니다. 면역형광 등 다양한 응용에 사용 가능합니다.
- 카탈로그번호
- HPA050321-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050321-100 Anti-PPP4R4 Antibody, protein phosphatase 4, regulatory subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050321-25 Anti-PPP4R4 Antibody, protein phosphatase 4, regulatory subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP4R4 Antibody
Anti-PPP4R4 Antibody
Target: protein phosphatase 4, regulatory subunit 4 (PPP4R4)
Type: Polyclonal Antibody
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PPP4R4, also known as protein phosphatase 4, regulatory subunit 4.
Alternative Gene Names
CFAP14, KIAA1622, PP4R4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 4, regulatory subunit 4 |
| Target Gene | PPP4R4 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (98%), Rat (96%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer Composition | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Preservative | Sodium azide (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



