CacheBy
Atlas Antibodies Anti-PPP4R4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP4R4 Antibody

상품 한눈에 보기

Human PPP4R4 단백질을 인식하는 토끼 폴리클로날 항체로, 단백질 인산화효소 4 조절 서브유닛 4 연구에 적합합니다. 높은 종 간 보존성(인간-마우스 98%)을 가지며, PrEST 항원으로 정제되었습니다. 면역형광 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050321-100 Anti-PPP4R4 Antibody, protein phosphatase 4, regulatory subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050321-25 Anti-PPP4R4 Antibody, protein phosphatase 4, regulatory subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP4R4 Antibody

Anti-PPP4R4 Antibody

Target: protein phosphatase 4, regulatory subunit 4 (PPP4R4)
Type: Polyclonal Antibody
Host: Rabbit
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PPP4R4, also known as protein phosphatase 4, regulatory subunit 4.


Alternative Gene Names

CFAP14, KIAA1622, PP4R4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protein phosphatase 4, regulatory subunit 4
Target Gene PPP4R4
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR
Verified Species Reactivity Human
Interspecies Homology Mouse (98%), Rat (96%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer Composition 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Preservative Sodium azide (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.