CacheBy
Atlas Antibodies Anti-PPP4R2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP4R2 Antibody

상품 한눈에 보기

Human PPP4R2 단백질에 대한 토끼 폴리클로날 항체로, 단백질 인산화효소 4 조절 소단위 2를 인식합니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

카탈로그번호
HPA073758-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073758-100 Anti-PPP4R2 Antibody, protein phosphatase 4, regulatory subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073758-25 Anti-PPP4R2 Antibody, protein phosphatase 4, regulatory subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP4R2 Antibody

Anti-PPP4R2 Antibody

Target: protein phosphatase 4, regulatory subunit 2 (PPP4R2)
Product Type: Polyclonal Antibody against Human PPP4R2


  • Immunohistochemistry (IHC)

Product Description

This polyclonal antibody targets the human PPP4R2 protein, a regulatory subunit of protein phosphatase 4.
It is affinity purified using the PrEST antigen as the affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protein phosphatase 4, regulatory subunit 2
Target Gene PPP4R2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASSSSQDKDKDSRCTRQH
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000052144 (72%), Rat ENSRNOG00000024647 (67%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer and Storage

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.