
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP4R4 Antibody
상품 한눈에 보기
인간 PPP4R4 단백질에 특이적인 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 친화정제 방식으로 높은 순도를 제공합니다. 인간에 대한 반응성이 검증되었습니다.
- 카탈로그번호
- HPA041866-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041866-100 Anti-PPP4R4 Antibody, protein phosphatase 4, regulatory subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041866-25 Anti-PPP4R4 Antibody, protein phosphatase 4, regulatory subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP4R4 Antibody
Anti-PPP4R4 Antibody
Target Protein: protein phosphatase 4, regulatory subunit 4
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human PPP4R4 (protein phosphatase 4, regulatory subunit 4).
Alternative Gene Names
CFAP14, KIAA1622, PP4R4
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021209 | 98% |
| Rat | ENSRNOG00000054052 | 96% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Recommended Applications
- Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



