
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP2R5D Antibody
상품 한눈에 보기
인간 PPP2R5D 단백질을 인식하는 토끼 폴리클로날 항체. IHC와 WB 검증 완료. 인간, 마우스, 랫트 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체. 단백질 발현 검증 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA029046-100 Anti-PPP2R5D Antibody, protein phosphatase 2, regulatory subunit B`, delta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029046-25 Anti-PPP2R5D Antibody, protein phosphatase 2, regulatory subunit B`, delta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP2R5D Antibody
Anti-PPP2R5D Antibody
Protein phosphatase 2, regulatory subunit B’, delta
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, independently validated)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human PPP2R5D.
Alternative Gene Names
- B56D
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein phosphatase 2, regulatory subunit B’, delta |
| Target Gene | PPP2R5D |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000016849 (99%)
- Mouse ENSMUSG00000059409 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



