
Atlas Antibodies Anti-PPP2R5D Antibody
인간 PPP2R5D 단백질을 인식하는 토끼 폴리클로날 항체. IHC와 WB 검증 완료. 인간, 마우스, 랫트 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체. 단백질 발현 검증 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP2R5D Antibody
Protein phosphatase 2, regulatory subunit B’, delta
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, independently validated)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human PPP2R5D.
Alternative Gene Names
- B56D
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein phosphatase 2, regulatory subunit B’, delta |
| Target Gene | PPP2R5D |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000016849 (99%)
- Mouse ENSMUSG00000059409 (99%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP3CA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5D Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|