CacheBy
Atlas Antibodies Anti-PPP2R5D Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP2R5D Antibody

상품 한눈에 보기

인간 PPP2R5D 단백질을 인식하는 토끼 폴리클로날 항체. IHC와 WB 검증 완료. 인간, 마우스, 랫트 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체. 단백질 발현 검증 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029046-100 Anti-PPP2R5D Antibody, protein phosphatase 2, regulatory subunit B`, delta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029046-25 Anti-PPP2R5D Antibody, protein phosphatase 2, regulatory subunit B`, delta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP2R5D Antibody

Anti-PPP2R5D Antibody

Protein phosphatase 2, regulatory subunit B’, delta

  • Immunohistochemistry (IHC)
  • Western Blot (WB, independently validated)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human PPP2R5D.

Alternative Gene Names

  • B56D

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Protein phosphatase 2, regulatory subunit B’, delta
Target Gene PPP2R5D
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000016849 (99%)
  • Mouse ENSMUSG00000059409 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.