CacheBy
Atlas Antibodies Anti-PPP2R5E Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP2R5E Antibody

상품 한눈에 보기

인간 PPP2R5E 단백질에 특이적인 폴리클로날 항체로, 단백질 인산화효소 2 조절 서브유닛 B, 엡실론 아이소폼을 타깃으로 함. IHC 및 ICC에 적합하며, 토끼에서 생산된 IgG 항체. PrEST 항원을 이용해 친화 정제됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA006034-100 Anti-PPP2R5E Antibody, protein phosphatase 2, regulatory subunit B`, epsilon isoform 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006034-25 Anti-PPP2R5E Antibody, protein phosphatase 2, regulatory subunit B`, epsilon isoform 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP2R5E Antibody

Anti-PPP2R5E Antibody

Target: protein phosphatase 2, regulatory subunit B`, epsilon isoform
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PPP2R5E.

Open Datasheet


Target Information

  • Target Protein: protein phosphatase 2, regulatory subunit B`, epsilon isoform
  • Target Gene: PPP2R5E
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000021051): 99%
  • Rat (ENSRNOG00000005045): 99%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.