AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP2R5C Antibody
상품 한눈에 보기
Human PPP2R5C 단백질에 대한 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. B56G/PR61G 유전자 대체명으로 알려져 있으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat에 반응성이 검증되었습니다.
- 카탈로그번호
- HPA027553-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027553-100 Anti-PPP2R5C Antibody, protein phosphatase 2, regulatory subunit B`, gamma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027553-25 Anti-PPP2R5C Antibody, protein phosphatase 2, regulatory subunit B`, gamma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP2R5C Antibody
Anti-PPP2R5C Antibody
Target Protein: protein phosphatase 2, regulatory subunit B`, gamma
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human PPP2R5C
Alternative Gene Names
- B56G
- PR61G
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 2, regulatory subunit B`, gamma |
| Target Gene | PPP2R5C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000017843 (96%) Rat ENSRNOG00000004973 (70%) |
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.