
Atlas Antibodies Anti-PPP2R5B Antibody
상품 한눈에 보기
Human PPP2R5B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. 높은 종간 반응성(인간, 마우스, 랫트)을 보이며 PrEST 항원을 이용해 친화 정제되었습니다. 40% glycerol/PBS buffer에 보존제가 포함되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP2R5B Antibody
Protein phosphatase 2, regulatory subunit B`, beta
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human PPP2R5B.
Alternative Gene Names
B56B, FLJ35411, PR61B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein phosphatase 2, regulatory subunit B`, beta |
| Target Gene | PPP2R5B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | Verified |
| Rat | Verified |
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000107330 (93%)
- Rat ENSRNOG00000021025 (93%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R3C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R5A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.