
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP2R3C Antibody
상품 한눈에 보기
인간 PPP2R3C 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB 실험에 적합하며, 토끼 유래 IgG 형식으로 제조되었습니다. 높은 종간 반응성(인간, 마우스, 랫트 100%)을 보이며, PrEST 항원을 이용해 친화 정제되었습니다.
- 카탈로그번호
- HPA040835-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040835-100 Anti-PPP2R3C Antibody, protein phosphatase 2, regulatory subunit B``, gamma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040835-25 Anti-PPP2R3C Antibody, protein phosphatase 2, regulatory subunit B``, gamma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP2R3C Antibody
Anti-PPP2R3C Antibody
Target: protein phosphatase 2, regulatory subunit B``, gamma
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human PPP2R3C.
Alternative Gene Names
C14orf10, FLJ20644, G4-1, G5PR
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 2, regulatory subunit B``, gamma |
| Target Gene | PPP2R3C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000021022): 100%
- Rat (ENSRNOG00000023591): 100%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



