CacheBy
Atlas Antibodies Anti-PPP1R8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R8 Antibody

상품 한눈에 보기

Human PPP1R8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 유전자 및 독립 항체 기반 검증 완료. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA027406-100 Anti-PPP1R8 Antibody, protein phosphatase 1, regulatory subunit 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027406-25 Anti-PPP1R8 Antibody, protein phosphatase 1, regulatory subunit 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R8 Antibody

Anti-PPP1R8 Antibody

Protein phosphatase 1, regulatory subunit 8


  • IHC (Independent Antibody Validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Genetic Validation)
    Genetic validation in WB by siRNA knockdown.

  • ICC


Product Description

Polyclonal antibody against Human PPP1R8


Alternative Gene Names

ard-1, ARD1, NIPP-1, NIPP1, PRO2047


Target Information

항목 내용
Target Protein protein phosphatase 1, regulatory subunit 8
Target Gene PPP1R8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000028882 (98%)
Rat ENSRNOG00000059550 (97%)

Antigen Sequence:
ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Validation
IHC Tooltip
WB Validation
WB Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.