
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP1R8 Antibody
상품 한눈에 보기
Human PPP1R8 단백질 인산화효소 조절 서브유닛 8을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. 고순도 Affinity 정제 및 안정적 글리세롤/PBS 버퍼 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA027417-100 Anti-PPP1R8 Antibody, protein phosphatase 1, regulatory subunit 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027417-25 Anti-PPP1R8 Antibody, protein phosphatase 1, regulatory subunit 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP1R8 Antibody
Anti-PPP1R8 Antibody
Protein phosphatase 1, regulatory subunit 8
Recommended Applications
IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Genetic Validation)
Genetic validation in WB by siRNA knockdown.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human PPP1R8.
Alternative Gene Names
ard-1, ARD1, NIPP-1, NIPP1, PRO2047
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein phosphatase 1, regulatory subunit 8 |
| Target Gene | PPP1R8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000028882 (98%), Rat ENSRNOG00000059550 (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



