Atlas Antibodies Anti-PPP1R8 Antibody

상품 한눈에 보기

Human PPP1R8 단백질 인산화효소 조절 서브유닛 8을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. 고순도 Affinity 정제 및 안정적 글리세롤/PBS 버퍼 제공.

카탈로그번호: HPA027417-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027417-100 Anti-PPP1R8 Antibody, protein phosphatase 1, regulatory subunit 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027417-25 Anti-PPP1R8 Antibody, protein phosphatase 1, regulatory subunit 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PPP1R8 Antibody

Anti-PPP1R8 Antibody

Protein phosphatase 1, regulatory subunit 8

Recommended Applications

IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic Validation)
Genetic validation in WB by siRNA knockdown.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PPP1R8.

Alternative Gene Names

ard-1, ARD1, NIPP-1, NIPP1, PRO2047

Open Datasheet

Target Information

항목	내용
Target Protein	Protein phosphatase 1, regulatory subunit 8
Target Gene	PPP1R8
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000028882 (98%), Rat ENSRNOG00000059550 (97%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.