
Atlas Antibodies Anti-PPP1R8 Antibody
상품 한눈에 보기
Human PPP1R8 단백질 인산화효소 조절 서브유닛 8을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. 고순도 Affinity 정제 및 안정적 글리세롤/PBS 버퍼 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP1R8 Antibody
Protein phosphatase 1, regulatory subunit 8
Recommended Applications
IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Genetic Validation)
Genetic validation in WB by siRNA knockdown.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human PPP1R8.
Alternative Gene Names
ard-1, ARD1, NIPP-1, NIPP1, PRO2047
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein phosphatase 1, regulatory subunit 8 |
| Target Gene | PPP1R8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000028882 (98%), Rat ENSRNOG00000059550 (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP1R9A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R42 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.