CacheBy
Atlas Antibodies Anti-PPP1R7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R7 Antibody

상품 한눈에 보기

Human PPP1R7 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 호스트에서 생산되었으며 PrEST 항원으로 정제되었습니다. 인간, 랫트, 마우스 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA034500-100 Anti-PPP1R7 Antibody, protein phosphatase 1, regulatory subunit 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034500-25 Anti-PPP1R7 Antibody, protein phosphatase 1, regulatory subunit 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R7 Antibody

Anti-PPP1R7 Antibody

Target Protein: protein phosphatase 1, regulatory subunit 7
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Independent antibody validation
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PPP1R7.


Alternative Gene Names

  • sds22

Open Datasheet


Specifications

항목 내용
Target Protein protein phosphatase 1, regulatory subunit 7
Target Gene PPP1R7
Antigen Sequence LENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATF
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000016974 (100%), Mouse ENSMUSG00000026275 (99%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.