
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP1R7 Antibody
상품 한눈에 보기
Human PPP1R7 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 호스트에서 생산되었으며 PrEST 항원으로 정제되었습니다. 인간, 랫트, 마우스 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA034500-100 Anti-PPP1R7 Antibody, protein phosphatase 1, regulatory subunit 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034500-25 Anti-PPP1R7 Antibody, protein phosphatase 1, regulatory subunit 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP1R7 Antibody
Anti-PPP1R7 Antibody
Target Protein: protein phosphatase 1, regulatory subunit 7
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent antibody validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human PPP1R7.
Alternative Gene Names
- sds22
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 1, regulatory subunit 7 |
| Target Gene | PPP1R7 |
| Antigen Sequence | LENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATF |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000016974 (100%), Mouse ENSMUSG00000026275 (99%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



