
Atlas Antibodies Anti-PPP1R3F Antibody
상품 한눈에 보기
Human PPP1R3F 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용해 친화 정제됨. 다양한 연구용 응용에 적합하며, 40% 글리세롤 및 PBS 완충액에 보존됨. Human에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP1R3F Antibody
Target: protein phosphatase 1, regulatory subunit 3F (PPP1R3F)
Type: Polyclonal Antibody against Human PPP1R3F
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Rabbit Polyclonal Antibody targeting Human PPP1R3F, a regulatory subunit of protein phosphatase 1.
Alternative Gene Names
- Hb2E
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 1, regulatory subunit 3F |
| Target Gene | PPP1R3F |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TDGGMSPSHPLGILTDRDLILKWPGPERALNSALAEEITLHYARLGRGVELIKDTEDPDDEGEGEEGLSVTPSSPEGDSPKESPPEILSGARSVVATMGDVWLP |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000039556 | 88% |
| Rat | ENSRNOG00000021440 | 28% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP1R7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R3F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R42 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R3G Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.