CacheBy
Atlas Antibodies Anti-PPP1R7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R7 Antibody

상품 한눈에 보기

Human PPP1R7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 종간 보존성과 검증된 특이성을 제공합니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

카탈로그번호
HPA034501-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034501-100 Anti-PPP1R7 Antibody, protein phosphatase 1, regulatory subunit 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034501-25 Anti-PPP1R7 Antibody, protein phosphatase 1, regulatory subunit 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R7 Antibody

Anti-PPP1R7 Antibody

Protein phosphatase 1, regulatory subunit 7

  • Immunohistochemistry (IHC)
  • Western Blot (WB, independent validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PPP1R7.

Alternative Gene Names

  • sds22

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Protein phosphatase 1, regulatory subunit 7
Target Gene PPP1R7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATF
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016974 (100%), Mouse ENSMUSG00000026275 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Material Safety Data Sheet MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.