
Atlas Antibodies Anti-PPP1R3A Antibody
인간 PPP1R3A 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 오쏘고날 검증에 적합하며 RNA-seq 데이터와 비교된 단백질 발현 확인에 사용. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP1R3A Antibody
Target: protein phosphatase 1 regulatory subunit 3A (PPP1R3A)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human PPP1R3A.
Alternative Gene Names
GM, PPP1R3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 1 regulatory subunit 3A |
| Target Gene | PPP1R3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFS |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000059350 (52%)
- Mouse ENSMUSG00000042717 (46%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP1R3E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R3F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R37 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|