
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP1R3E Antibody
상품 한눈에 보기
Human PPP1R3E 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 호스트에서 생산된 IgG 형 항체. PrEST 항원 기반 친화 정제 방식 사용. 인간에 대한 반응성 검증 완료.
- 카탈로그번호
- HPA061600-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061600-100 Anti-PPP1R3E Antibody, protein phosphatase 1, regulatory subunit 3E 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061600-25 Anti-PPP1R3E Antibody, protein phosphatase 1, regulatory subunit 3E 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP1R3E Antibody
Anti-PPP1R3E Antibody
Target Protein: protein phosphatase 1, regulatory subunit 3E
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human PPP1R3E.
Alternative Gene Names
- FLJ00089
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000072494 | 93% |
| Rat | ENSRNOG00000014904 | 90% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



