CacheBy
Atlas Antibodies Anti-PPP1R37 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R37 Antibody

상품 한눈에 보기

인간 PPP1R37 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간 및 설치류 종에서 높은 반응성 확인. 안정한 PBS/glycerol 버퍼로 보존.

카탈로그번호
HPA041500-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041500-100 Anti-PPP1R37 Antibody, protein phosphatase 1, regulatory subunit 37 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041500-25 Anti-PPP1R37 Antibody, protein phosphatase 1, regulatory subunit 37 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R37 Antibody

Anti-PPP1R37 Antibody

Target: protein phosphatase 1, regulatory subunit 37
Type: Polyclonal Antibody against Human PPP1R37


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human PPP1R37 protein.


Alternative Gene Names

  • LRRC68

Open Datasheet


Target Information

항목 내용
Target Protein protein phosphatase 1, regulatory subunit 37
Target Gene PPP1R37
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (94%), Mouse (94%)

Antigen Sequence:
TVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), containing 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.