
Atlas Antibodies Anti-CLINT1 Antibody
인간 CLINT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 인간, 생쥐, 랫트에 반응성이 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 단백질 발현 검증과 세포 내 단백질 분석에 유용합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CLINT1 Antibody
Target: clathrin interactor 1 (CLINT1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, independent antibody validation)
- Immunocytochemistry (ICC)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human CLINT1.
Alternative Gene Names
CLINT, ENTH, EPNR, KIAA0171
Antigen Information
Antigen Sequence (PrEST):
DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGS
Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000006169 (96%)
- Rat ENSRNOG00000005406 (93%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CLIP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLINT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLINT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLIC6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLIC4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|