
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLINT1 Antibody
상품 한눈에 보기
Human CLINT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교로 검증된 신뢰성 높은 데이터 제공. Human, Mouse, Rat 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043280-100 Anti-CLINT1 Antibody, clathrin interactor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043280-25 Anti-CLINT1 Antibody, clathrin interactor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLINT1 Antibody
Anti-CLINT1 Antibody
Target: clathrin interactor 1 (CLINT1)
Type: Polyclonal Antibody against Human CLINT1
Host: Rabbit
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human CLINT1, also known as clathrin interactor 1.
Alternative Gene Names
CLINT, ENTH, EPNR, KIAA0171
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGS
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000006169 | 96% |
| Rat | ENSRNOG00000005406 | 93% |
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



