
Atlas Antibodies Anti-CLINT1 Antibody
상품 한눈에 보기
Human CLINT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교로 검증된 신뢰성 높은 데이터 제공. Human, Mouse, Rat 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CLINT1 Antibody
Target: clathrin interactor 1 (CLINT1)
Type: Polyclonal Antibody against Human CLINT1
Host: Rabbit
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human CLINT1, also known as clathrin interactor 1.
Alternative Gene Names
CLINT, ENTH, EPNR, KIAA0171
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGS
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000006169 | 96% |
| Rat | ENSRNOG00000005406 | 93% |
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CLIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLIP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLINT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLINT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLIC6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.