Atlas Antibodies Anti-CLINT1 Antibody

상품 한눈에 보기

Human CLINT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교로 검증된 신뢰성 높은 데이터 제공. Human, Mouse, Rat 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043280-100 Anti-CLINT1 Antibody, clathrin interactor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043280-25 Anti-CLINT1 Antibody, clathrin interactor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CLINT1 Antibody

Anti-CLINT1 Antibody

Target: clathrin interactor 1 (CLINT1)
Type: Polyclonal Antibody against Human CLINT1
Host: Rabbit

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Independent Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human CLINT1, also known as clathrin interactor 1.

Alternative Gene Names

CLINT, ENTH, EPNR, KIAA0171

Open Datasheet (PDF)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGS

Verified Species Reactivity

Human
Mouse
Rat

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000006169	96%
Rat	ENSRNOG00000005406	93%

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand