CacheBy
Atlas Antibodies Anti-CLIC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLIC4 Antibody

상품 한눈에 보기

인간 CLIC4 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터와의 정합 검증을 통해 높은 신뢰도를 제공합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. PBS-글리세롤 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060804-100 Anti-CLIC4 Antibody, chloride intracellular channel 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060804-25 Anti-CLIC4 Antibody, chloride intracellular channel 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLIC4 Antibody

Anti-CLIC4 Antibody

Target: Chloride Intracellular Channel 4 (CLIC4)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against human CLIC4.


Alternative Gene Names

CLIC4L, DKFZP566G223, H1, huH1, P64H1

Open Datasheet (PDF)


Antigen Information

  • Target Protein: Chloride intracellular channel 4
  • Target Gene: CLIC4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000037242 98%
Rat ENSRNOG00000018109 97%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.