
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CEP162 Antibody
상품 한눈에 보기
Human CEP162 단백질을 인식하는 Rabbit Polyclonal 항체로, centrosomal protein 162kDa 검출에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030173-100 Anti-CEP162 Antibody, centrosomal protein 162kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030173-25 Anti-CEP162 Antibody, centrosomal protein 162kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CEP162 Antibody
Anti-CEP162 Antibody
Target: Centrosomal protein 162kDa (CEP162)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human CEP162, designed for detection of centrosomal protein 162kDa. Suitable for various research applications.
Alternative Gene Names
C6orf84, KIAA1009, QN1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Centrosomal protein 162kDa |
| Target Gene | CEP162 |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (58%), Rat (56%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)
Recommended Applications
- Immunohistochemistry (IHC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



