
Atlas Antibodies Anti-CEP162 Antibody
상품 한눈에 보기
Human CEP162 단백질을 인식하는 Rabbit Polyclonal 항체로, centrosomal protein 162kDa 검출에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CEP162 Antibody
Target: Centrosomal protein 162kDa (CEP162)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human CEP162, designed for detection of centrosomal protein 162kDa. Suitable for various research applications.
Alternative Gene Names
C6orf84, KIAA1009, QN1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Centrosomal protein 162kDa |
| Target Gene | CEP162 |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (58%), Rat (56%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)
Recommended Applications
- Immunohistochemistry (IHC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CEP250 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP192 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP162 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP170 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP19 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.