CacheBy
Atlas Antibodies Anti-CEP162 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP162 Antibody

상품 한눈에 보기

Human CEP162 단백질을 인식하는 Rabbit Polyclonal 항체로, centrosomal protein 162kDa 검출에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030173-100 Anti-CEP162 Antibody, centrosomal protein 162kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030173-25 Anti-CEP162 Antibody, centrosomal protein 162kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP162 Antibody

Anti-CEP162 Antibody

Target: Centrosomal protein 162kDa (CEP162)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CEP162, designed for detection of centrosomal protein 162kDa. Suitable for various research applications.

Alternative Gene Names

C6orf84, KIAA1009, QN1

Target Information

항목 내용
Target Protein Centrosomal protein 162kDa
Target Gene CEP162
Verified Species Reactivity Human
Interspecies Homology Mouse (58%), Rat (56%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)

  • Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.