
Atlas Antibodies Anti-CEP19 Antibody
인간 CEP19 단백질을 표적으로 하는 폴리클로날 항체. IHC 정량 분석 및 RNA-seq 데이터 비교를 통한 직교 검증 완료. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제 방식 사용. 인간 반응성 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CEP19 Antibody
Centrosomal protein 19kDa
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CEP19
Alternative Gene Names
C3orf34, MGC14126
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Centrosomal protein 19kDa |
| Target Gene | CEP19 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000024924 | 85% |
| Mouse | ENSMUSG00000035790 | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CEP162 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP170 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP170 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|