Atlas Antibodies Anti-CEP192 Antibody

상품 한눈에 보기

인간 CEP192 단백질을 인식하는 폴리클로날 항체로, 세포 중심체 단백질 연구에 적합함. 토끼에서 유래한 IgG 항체이며, PrEST 항원으로 특이적 정제됨. 인간에 대해 검증된 반응성을 가지며, IHC 등 다양한 응용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040503-100 Anti-CEP192 Antibody, centrosomal protein 192kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040503-25 Anti-CEP192 Antibody, centrosomal protein 192kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human CEP192, generated in rabbit and affinity purified using the PrEST antigen as ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KGVDESGDVFRATYAAFRCSPISGLLESHGIQKVSITFLPRGRGDYAQFWDVECHPLKEPHMKHTLRFQLSGQSIEAENEPENACLSTDSLI

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC)
Safety	Material Safety Data Sheet