CacheBy
Atlas Antibodies Anti-CEP19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP19 Antibody

상품 한눈에 보기

인간 CEP19 단백질을 인식하는 폴리클로날 항체로, 중심소 단백질 연구에 적합합니다. IHC를 통한 단백질 발현 검증에 사용되며, Rabbit에서 생산된 IgG 형태입니다. 고순도 친화정제 제품으로 다양한 조직 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047614-100 Anti-CEP19 Antibody, centrosomal protein 19kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047614-25 Anti-CEP19 Antibody, centrosomal protein 19kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP19 Antibody

Anti-CEP19 Antibody

Centrosomal protein 19kDa

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human CEP19.

Alternative Gene Names

C3orf34, MGC14126

Open Datasheet

Target Information

항목 내용
Target Protein Centrosomal protein 19kDa
Target Gene CEP19
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

유전자 ID 일치율
Rat ENSRNOG00000024924 85%
Mouse ENSMUSG00000035790 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.