
Atlas Antibodies Anti-CEP19 Antibody
상품 한눈에 보기
인간 CEP19 단백질을 인식하는 폴리클로날 항체로, 중심소 단백질 연구에 적합합니다. IHC를 통한 단백질 발현 검증에 사용되며, Rabbit에서 생산된 IgG 형태입니다. 고순도 친화정제 제품으로 다양한 조직 연구에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CEP19 Antibody
Centrosomal protein 19kDa
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CEP19.
Alternative Gene Names
C3orf34, MGC14126
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Centrosomal protein 19kDa |
| Target Gene | CEP19 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| 종 | 유전자 ID | 일치율 |
|---|---|---|
| Rat | ENSRNOG00000024924 | 85% |
| Mouse | ENSMUSG00000035790 | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CEP170 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP170 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEP164 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.