Thermo Fisher Scientific ABCA4 Polyclonal Antibody
ABCA4 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 정제 방식으로 제조되었습니다. 동결건조 형태로 제공되며, -20°C에서 보관합니다.
- 카탈로그번호
- PA578688
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ABCA4 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890–1927aa: FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745804 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein encoded by the ABCA4 gene in humans. It belongs to the ATP-binding cassette transporter gene sub-family A (ABC1), found exclusively in multicellular eukaryotes.
This gene is mapped to chromosome 1p21–p13 and is expressed exclusively in retinal photoreceptor cells, where it mediates transport of essential molecules across the photoreceptor cell membrane.
Immunofluorescence microscopy and Western blot analyses have shown that ABCR is present in foveal and peripheral cone, as well as rod photoreceptors. Loss of ABCR function is associated with Stargardt macular dystrophy due to foveal cone degeneration.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.