
Thermo Fisher Scientific ABCA4 Polyclonal Antibody
ABCA4 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 정제 방식으로 제조되었습니다. 동결건조 형태로 제공되며, -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890–1927aa: FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745804 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein encoded by the ABCA4 gene in humans. It belongs to the ATP-binding cassette transporter gene sub-family A (ABC1), found exclusively in multicellular eukaryotes.
This gene is mapped to chromosome 1p21–p13 and is expressed exclusively in retinal photoreceptor cells, where it mediates transport of essential molecules across the photoreceptor cell membrane.
Immunofluorescence microscopy and Western blot analyses have shown that ABCR is present in foveal and peripheral cone, as well as rod photoreceptors. Loss of ABCR function is associated with Stargardt macular dystrophy due to foveal cone degeneration.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ABCB6 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific BSEP Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ABCA4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific MEF2B Polyclonal Antibody
731,200원

Thermo Fisher Scientific
Thermo Fisher Scientific Bub1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|