
Thermo Fisher Scientific MAOA Polyclonal Antibody
MAOA 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot, IHC, ICC, Flow Cytometry에 적합합니다. 사람, 마우스, 랫트 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MAOA Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457–493aa: REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | –20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746738 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes monoamine oxidase A (MAOA), an enzyme that degrades amine neurotransmitters such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutations in this gene result in monoamine oxidase deficiency, also known as Brunner syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
