Atlas Antibodies Anti-CCP110 Antibody

상품 한눈에 보기

인체 CCP110 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원 기반으로 제작되었으며, 오쏘고날 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교 확인할 수 있습니다. Rabbit IgG 형식으로 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039402-100 Anti-CCP110 Antibody, centriolar coiled coil protein 110kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039402-25 Anti-CCP110 Antibody, centriolar coiled coil protein 110kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CCP110 Antibody

Anti-CCP110 Antibody

Target: centriolar coiled coil protein 110kDa (CCP110)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC

Product Description

Polyclonal antibody against human CCP110.

Alternative Gene Names

CP110
KIAA0419

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
DKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Rat ENSRNOG00000027405 (79%)
Mouse ENSMUSG00000033904 (75%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand