
Atlas Antibodies Anti-CCP110 Antibody
상품 한눈에 보기
인체 CCP110 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원 기반으로 제작되었으며, 오쏘고날 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교 확인할 수 있습니다. Rabbit IgG 형식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CCP110 Antibody
Target: centriolar coiled coil protein 110kDa (CCP110)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - ICC
Product Description
Polyclonal antibody against human CCP110.
Alternative Gene Names
- CP110
- KIAA0419
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
DKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000027405 (79%)
- Mouse ENSMUSG00000033904 (75%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CCR10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCPG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCP110 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCPG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCNYL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.