CacheBy
Atlas Antibodies Anti-CCPG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCPG1 Antibody

상품 한눈에 보기

Human CCPG1 단백질을 인식하는 토끼 폴리클로날 항체로, 세포주기 진행 관련 연구에 적합. PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009432-100 Anti-CCPG1 Antibody, cell cycle progression 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009432-25 Anti-CCPG1 Antibody, cell cycle progression 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCPG1 Antibody

Anti-CCPG1 Antibody

Target: Cell Cycle Progression 1 (CCPG1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CCPG1 protein. Suitable for use in various immunoassays.


Alternative Gene Names

CPR8, KIAA1254

Open Datasheet (PDF)


Target Information

  • Target Protein: Cell Cycle Progression 1
  • Target Gene: CCPG1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000034563 76%
Rat ENSRNOG00000053428 73%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.