CacheBy
Atlas Antibodies Anti-CCPG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCPG1 Antibody

상품 한눈에 보기

Human CCPG1 단백질을 인식하는 폴리클로날 항체로, 세포주기 관련 연구에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. Human에 반응하며 Mouse 및 Rat과도 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026861-100 Anti-CCPG1 Antibody, cell cycle progression 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026861-25 Anti-CCPG1 Antibody, cell cycle progression 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCPG1 Antibody

Anti-CCPG1 Antibody

Target Information

  • Target Protein: Cell cycle progression 1
  • Target Gene: CCPG1
  • Alternative Gene Names: CPR8, KIAA1254

Product Description

Polyclonal antibody against human CCPG1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000034563 (76%)
  • Rat ENSRNOG00000053428 (73%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications ICC (Immunocytochemistry)
Safety Info Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.