Thermo Fisher Scientific GFI1 Polyclonal Antibody
GFI1 단백질을 표적하는 Thermo Fisher Scientific의 폴리클로날 항체. 사람, 생쥐, 랫트 반응성. IHC(P) 등 다양한 연구용 응용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체. -20°C 보관, 연구용 전용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GFI1 Polyclonal Antibody
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746421 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
GFI1 is a nuclear zinc finger (ZF) transcriptional repressor that plays an important role in hematopoiesis and inner ear development, and has been implicated in lymphomagenesis. The GFI1 protein expression is regulated by the ubiquitin-proteasome system. Ubiquitin ligase Triad1 interacts with the DNA-binding domain of GFI1, repressing transcription by directly binding to consensus DNA sequences in target gene promoters. Deficiency of GFI1 causes neutropenia and accumulation of granulomonocytic precursor cells, reminiscent of a myelodysplastic syndrome in mice.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.