Thermo Fisher Scientific GFI1 Polyclonal Antibody
GFI1 단백질을 표적하는 Thermo Fisher Scientific의 폴리클로날 항체. 사람, 생쥐, 랫트 반응성. IHC(P) 등 다양한 연구용 응용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체. -20°C 보관, 연구용 전용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746421 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
GFI1 is a nuclear zinc finger (ZF) transcriptional repressor that plays an important role in hematopoiesis and inner ear development, and has been implicated in lymphomagenesis. The GFI1 protein expression is regulated by the ubiquitin-proteasome system. Ubiquitin ligase Triad1 interacts with the DNA-binding domain of GFI1, repressing transcription by directly binding to consensus DNA sequences in target gene promoters. Deficiency of GFI1 causes neutropenia and accumulation of granulomonocytic precursor cells, reminiscent of a myelodysplastic syndrome in mice.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Growth Hormone Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Growth Hormone Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GFI1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GFR alpha-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GDA Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|