Thermo Fisher Scientific XPA Polyclonal Antibody
Rabbit polyclonal antibody recognizing human XPA protein. Suitable for Western blot at 0.1–0.5 µg/mL. Lyophilized form, reconstitutes to 500 µg/mL. Detects DNA damage repair protein involved in nucleotide excision repair. For research use only.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific XPA Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
Product Specifications
| Item | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human XPA (174–208 aa: QWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL (after reconstitution) |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747350 |
Product Specific Information
Add 0.2 mL of distilled water to reconstitute, yielding a concentration of 500 µg/mL.
Target Information
The XPA (xeroderma pigmentosum group A) protein specifically recognizes UV- or chemically-damaged DNA lesions and initiates the nucleotide excision repair process.
XPA interacts with replication protein A (RPA) and excision repair cross-complementing 1 protein (ERCC1).
Defects in this repair pathway can lead to unrepaired DNA lesions, accumulation of mutations, and increased cancer risk.
Patients with xeroderma pigmentosum exhibit over 2000-fold higher risk of developing skin cancer in sun-exposed areas.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.