Thermo Fisher Scientific XPA Polyclonal Antibody
Rabbit polyclonal antibody recognizing human XPA protein. Suitable for Western blot at 0.1–0.5 µg/mL. Lyophilized form, reconstitutes to 500 µg/mL. Detects DNA damage repair protein involved in nucleotide excision repair. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
Product Specifications
| Item | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human XPA (174–208 aa: QWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL (after reconstitution) |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747350 |
Product Specific Information
Add 0.2 mL of distilled water to reconstitute, yielding a concentration of 500 µg/mL.
Target Information
The XPA (xeroderma pigmentosum group A) protein specifically recognizes UV- or chemically-damaged DNA lesions and initiates the nucleotide excision repair process.
XPA interacts with replication protein A (RPA) and excision repair cross-complementing 1 protein (ERCC1).
Defects in this repair pathway can lead to unrepaired DNA lesions, accumulation of mutations, and increased cancer risk.
Patients with xeroderma pigmentosum exhibit over 2000-fold higher risk of developing skin cancer in sun-exposed areas.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific XRCC3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific XRCC1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific XPA Polyclonal Antibody
599,200원
Thermo Fisher Scientific
Thermo Fisher Scientific XDH Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific WWOX Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|