Thermo Fisher Scientific RPA70 Monoclonal Antibody (11H4)
RPA70 단백질을 인식하는 Mouse IgG2b 단클론 항체로, WB, IHC, ICC, Flow Cytometry에 사용 가능. 인간, 마우스, 비인간 영장류 반응성. DNA 복제 및 수선 관련 연구에 적합. Lyophilized 형태로 제공되며 재구성 시 500 µg/mL 농도.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1x10^6 cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 11H4 |
| Immunogen | Synthetic peptide corresponding to C-terminus of human RPA70 (533–568aa: QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term; for long term store at -20°C, avoid freeze/thaw cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2884060 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RPA70 plays an essential role in several cellular processes in DNA metabolism including replication, recombination, and DNA repair. It binds and stabilizes single-stranded DNA intermediates, preventing complementary DNA strands from reannealing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GAA Monoclonal Antibody (2G7)
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Collagen IV Monoclonal Antibody (3G3)
646,200원
Thermo Fisher Scientific
Thermo Fisher Scientific RPA70 Monoclonal Antibody (11H4)
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific BAK1 Monoclonal Antibody (4C2)
646,200원
Thermo Fisher Scientific
Thermo Fisher Scientific NRF1 Monoclonal Antibody (2G4)
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|