원본
Thermo Fisher Scientific RPA70 Monoclonal Antibody (11H4)
상품 한눈에 보기
RPA70 단백질을 인식하는 Mouse IgG2b 단클론 항체로, WB, IHC, ICC, Flow Cytometry에 사용 가능. 인간, 마우스, 비인간 영장류 반응성. DNA 복제 및 수선 관련 연구에 적합. Lyophilized 형태로 제공되며 재구성 시 500 µg/mL 농도.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 03:12
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA536226 RPA70 Monoclonal Antibody (11H4) 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific RPA70 Monoclonal Antibody (11H4)
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1x10^6 cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 11H4 |
| Immunogen | Synthetic peptide corresponding to C-terminus of human RPA70 (533–568aa: QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term; for long term store at -20°C, avoid freeze/thaw cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2884060 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RPA70 plays an essential role in several cellular processes in DNA metabolism including replication, recombination, and DNA repair. It binds and stabilizes single-stranded DNA intermediates, preventing complementary DNA strands from reannealing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific GAA Monoclonal Antibody (2G7)680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Collagen IV Monoclonal Antibody (3G3)646,200원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific BAK1 Monoclonal Antibody (4C2)646,200원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NRF1 Monoclonal Antibody (2G4)680,400원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.