Thermo Fisher Scientific MMP11 Polyclonal Antibody
MMP11 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot과 IHC(P)에서 검증됨. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도 유지. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104–135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746793 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Stromelysin (MMP-11)은 matrix metalloproteinase 계열의 단백질로, proteoglycan, fibronectin, laminin, casein, 그리고 collagen의 비나선형 영역을 분해할 수 있는 넓은 기질 특이성을 가집니다.
Stromelysin-3 (MMP-11) 유전자는 침습성 유방암 세포를 둘러싼 기질 세포에서 특이적으로 발현되는 것으로 처음 확인되었습니다.
MMP-11은 염색체 22의 장완에 위치하며, 양성 종양보다 악성 종양에서 더 특이적으로 발현됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MMP10 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MICB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP11 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CD10 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 0 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|