원본
Thermo Fisher Scientific MMP11 Polyclonal Antibody
상품 한눈에 보기
MMP11 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot과 IHC(P)에서 검증됨. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도 유지. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 01:10
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579678 MMP11 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific MMP11 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104–135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746793 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Stromelysin (MMP-11)은 matrix metalloproteinase 계열의 단백질로, proteoglycan, fibronectin, laminin, casein, 그리고 collagen의 비나선형 영역을 분해할 수 있는 넓은 기질 특이성을 가집니다.
Stromelysin-3 (MMP-11) 유전자는 침습성 유방암 세포를 둘러싼 기질 세포에서 특이적으로 발현되는 것으로 처음 확인되었습니다.
MMP-11은 염색체 22의 장완에 위치하며, 양성 종양보다 악성 종양에서 더 특이적으로 발현됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific MMP10 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MICB Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CD10 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Aquaporin 0 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.