Atlas Antibodies Anti-CBLB Antibody

상품 한눈에 보기

Human CBLB 단백질을 인식하는 Rabbit Polyclonal 항체로, E3 유비퀴틴 리가아제 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, 고순도 Affinity Purified 제품. 인간에 대해 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA018327-100 Anti-CBLB Antibody, Cbl proto-oncogene B, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA018327-25 Anti-CBLB Antibody, Cbl proto-oncogene B, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Cbl proto-oncogene B, E3 ubiquitin protein ligase

면역조직화학 (IHC)

Polyclonal Antibody against Human CBLB

Cbl-b, RNF56

항목	내용
Target Protein	Cbl proto-oncogene B, E3 ubiquitin protein ligase
Target Gene	CBLB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000001982 (91%), Mouse ENSMUSG00000022637 (87%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand