
Atlas Antibodies Anti-CBLB Antibody
상품 한눈에 보기
Human CBLB 단백질을 인식하는 Rabbit Polyclonal 항체로, E3 유비퀴틴 리가아제 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, 고순도 Affinity Purified 제품. 인간에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CBLB Antibody
Cbl proto-oncogene B, E3 ubiquitin protein ligase
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human CBLB
Alternative Gene Names
Cbl-b, RNF56
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cbl proto-oncogene B, E3 ubiquitin protein ligase |
| Target Gene | CBLB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000001982 (91%), Mouse ENSMUSG00000022637 (87%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도와 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
