CacheBy
Atlas Antibodies Anti-CBLL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CBLL1 Antibody

상품 한눈에 보기

Human CBLL1 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 인간 및 설치류에서 높은 교차 반응성을 보입니다.

카탈로그번호
HPA021773-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021773-100 Anti-CBLL1 Antibody, Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021773-25 Anti-CBLL1 Antibody, Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CBLL1 Antibody

Anti-CBLL1 Antibody

Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase


  • IHC (Independent antibody validation)
  • WB (Western Blot)

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human CBLL1


Alternative Gene Names

  • FLJ23109
  • HAKAI
  • RNF188

Open Datasheet


Target Information

항목 내용
Target Protein Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase
Target Gene CBLL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000007253 (99%), Mouse ENSMUSG00000020659 (99%)

Antigen Sequence:
RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.