Atlas Antibodies Anti-CBL Antibody

상품 한눈에 보기

Human CBL 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 단백질 발현 확인. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027956-100 Anti-CBL Antibody, Cbl proto-oncogene, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027956-25 Anti-CBL Antibody, Cbl proto-oncogene, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CBL Antibody

Anti-CBL Antibody

Cbl proto-oncogene, E3 ubiquitin protein ligase

Recommended Applications

IHC (Orthogonal validation)
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CBL

Alternative Gene Names

c-Cbl, CBL2, RNF55

Open Datasheet

Target Information

항목	내용
Target Protein	Cbl proto-oncogene, E3 ubiquitin protein ligase
Target Gene	CBL
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000008444 (84%), Mouse ENSMUSG00000034342 (83%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand