
Atlas Antibodies Anti-CARTPT Antibody
상품 한눈에 보기
Human CART prepropeptide를 타겟으로 하는 Rabbit Polyclonal Antibody. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원을 이용한 Affinity purification으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CARTPT Antibody
Target Information
- Target Protein: CART prepropeptide
- Target Gene: CARTPT
- Alternative Gene Names: CART
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal Antibody against Human CARTPT.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000017712 | 84% |
| Mouse | ENSMUSG00000021647 | 84% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet
Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CARS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CASC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARTPT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARNS1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.