Atlas Antibodies Anti-CARTPT Antibody

상품 한눈에 보기

Human CART prepropeptide를 타겟으로 하는 Rabbit Polyclonal Antibody. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원을 이용한 Affinity purification으로 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046278-100 Anti-CARTPT Antibody, CART prepropeptide 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046278-25 Anti-CARTPT Antibody, CART prepropeptide 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CARTPT Antibody

Anti-CARTPT Antibody

Target Information

Target Protein: CART prepropeptide
Target Gene: CARTPT
Alternative Gene Names: CART

Recommended Applications

IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal Antibody against Human CARTPT.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000017712	84%
Mouse	ENSMUSG00000021647	84%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand