CacheBy
Atlas Antibodies Anti-CASC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CASC1 Antibody

상품 한눈에 보기

인체 CASC1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 분석에 적합하며 RNA-seq 데이터 기반 Orthogonal 검증 수행. 토끼 유래 IgG 항체로 높은 특이성과 재현성 제공. 40% glycerol PBS buffer로 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039662-100 Anti-CASC1 Antibody, cancer susceptibility candidate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039662-25 Anti-CASC1 Antibody, cancer susceptibility candidate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CASC1 Antibody

Anti-CASC1 Antibody

Target: Cancer Susceptibility Candidate 1 (CASC1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human CASC1.


Alternative Gene Names

  • FLJ10921
  • LAS1
  • PPP1R54

Open Datasheet


Target Information

항목 내용
Target Protein Cancer susceptibility candidate 1
Target Gene CASC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ESEAIKCEREMKVLSETVSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKY
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000043541 (65%), Rat ENSRNOG00000027630 (61%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.