Atlas Antibodies Anti-CARS2 Antibody

상품 한눈에 보기

Human CARS2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, 40% 글리세롤 기반 완충액에 보존됩니다. 인간에 특이적이며, 생쥐 및 랫트와 부분적 교차 반응성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041776-100 Anti-CARS2 Antibody, cysteinyl-tRNA synthetase 2, mitochondrial (putative) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041776-25 Anti-CARS2 Antibody, cysteinyl-tRNA synthetase 2, mitochondrial (putative) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cysteinyl-tRNA synthetase 2, mitochondrial (putative)
Supplier: Atlas Antibodies

Polyclonal antibody against Human CARS2.

항목	내용
Target Protein	cysteinyl-tRNA synthetase 2, mitochondrial (putative)
Target Gene	CARS2
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
Verified Species Reactivity	Human
Ortholog Identity	Mouse (75%), Rat (73%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet