
Atlas Antibodies Anti-CADM2 Antibody
Human CADM2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Orthogonal validation에 적합. Affinity purification으로 고순도 확보. 다양한 종에서 높은 보존성 보유. 안정한 PBS/glycerol buffer에 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CADM2 Antibody
Target: Cell Adhesion Molecule 2 (CADM2)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CADM2 protein.
Alternative Gene Names
IGSF4D, Necl-3, NECL3, SynCAM2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cell adhesion molecule 2 |
| Target Gene | CADM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000030840 (94%), Mouse ENSMUSG00000064115 (92%) |
Antigen Sequence:
EIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CADM4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CADPS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CADM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CACYBP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CACUL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|