CacheBy
Atlas Antibodies Anti-CADM4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CADM4 Antibody

상품 한눈에 보기

Human CADM4 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 일치를 검증하였습니다. 친화 정제된 고품질 항체로 신뢰성 높은 연구 결과를 제공합니다.

카탈로그번호
HPA012612-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012612-100 Anti-CADM4 Antibody, cell adhesion molecule 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012612-25 Anti-CADM4 Antibody, cell adhesion molecule 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CADM4 Antibody

Anti-CADM4 Antibody

Target: Cell adhesion molecule 4 (CADM4)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Protein expression verified by comparison with RNA-seq data in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human CADM4.


Alternative Gene Names

IGSF4C, Necl-4, SynCAM4, TSLL2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Cell adhesion molecule 4
Target Gene CADM4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000024243 (98%)
  • Mouse ENSMUSG00000054793 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.