CacheBy
Atlas Antibodies Anti-CACYBP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CACYBP Antibody

상품 한눈에 보기

Human CACYBP 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. S100A6BP, SIP 유전자 대체명으로 알려져 있으며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에서 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025753-100 Anti-CACYBP Antibody, calcyclin binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025753-25 Anti-CACYBP Antibody, calcyclin binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CACYBP Antibody

Anti-CACYBP Antibody

Target Protein: calcyclin binding protein
Alternative Gene Names: S100A6BP, SIP

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CACYBP.

Open Datasheet

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT

Species Reactivity

  • Verified Reactivity: Human, Mouse, Rat
  • Interspecies Identity:
    • Mouse ENSMUSG00000014226 (84%)
    • Rat ENSRNOG00000002572 (83%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.