
Atlas Antibodies Anti-CAD Antibody
상품 한눈에 보기
인간 CAD 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 실험에 적합. 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG, PrEST 항원으로 정제된 고순도 항체. 40% 글리세롤 및 PBS 완충액에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CAD Antibody
Target: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Supplier: Atlas Antibodies
Recommended Applications
- WB (Independent validation)
- ICC
Independent Validation:
Validation of protein expression in Western Blot by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human CAD
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase |
| Target Gene | CAD |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
