
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CAD Antibody
상품 한눈에 보기
인간 CAD 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 실험에 적합. 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG, PrEST 항원으로 정제된 고순도 항체. 40% 글리세롤 및 PBS 완충액에 보존.
- 카탈로그번호
- HPA069341-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA069341-100 Anti-CAD Antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069341-25 Anti-CAD Antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CAD Antibody
Anti-CAD Antibody
Target: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Supplier: Atlas Antibodies
Recommended Applications
- WB (Independent validation)
- ICC
Independent Validation:
Validation of protein expression in Western Blot by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human CAD
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase |
| Target Gene | CAD |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



