CacheBy
Atlas Antibodies Anti-CAD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAD Antibody

상품 한눈에 보기

인간 CAD 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 실험에 적합. 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG, PrEST 항원으로 정제된 고순도 항체. 40% 글리세롤 및 PBS 완충액에 보존.

카탈로그번호
HPA069341-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069341-100 Anti-CAD Antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069341-25 Anti-CAD Antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAD Antibody

Anti-CAD Antibody

Target: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Supplier: Atlas Antibodies


  • WB (Independent validation)
  • ICC

Independent Validation:
Validation of protein expression in Western Blot by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human CAD

Open Datasheet


Specifications

항목 내용
Target Protein carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Target Gene CAD
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL

제품 이미지

Enhanced Validation
WB Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.