Atlas Antibodies Anti-CAD Antibody

상품 한눈에 보기

Human CAD 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합. Rabbit 소스 IgG 항체이며 PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증된 고품질 연구용 시약.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057266-100 Anti-CAD Antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057266-25 Anti-CAD Antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Target Gene: CAD

WB (Independent Validation): Validation of protein expression in Western blot by comparing independent antibodies targeting different epitopes of the protein.
ICC: Immunocytochemistry application verified.

Polyclonal Antibody against Human CAD
Open Datasheet

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVL

항목	내용
Verified Species Reactivity	Human
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.